General Information

  • ID:  hor006532
  • Uniprot ID:  P12026
  • Protein name:  Acyl-CoA-binding protein
  • Gene name:  DBI
  • Organism:  Sus scrofa (Pig)
  • Family:  ACBP family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0000062 fatty-acyl-CoA binding; GO:0008289 lipid binding
  • GO BP:  GO:0006631 fatty acid metabolic process; GO:0042742 defense response to bacterium
  • GO CC:  GO:0005783 endoplasmic reticulum; GO:0005794 Golgi apparatus

Sequence Information

  • Sequence:  SQAEFEKAAEEVKNLKTKPADDEMLFIYSHYKQATVGDINTERPGILDLKGKAKWDAWNGLKGTSKEDAMKAYINKVEELKKKYGI
  • Length:  86(2-87)
  • Propeptide:  MSQAEFEKAAEEVKNLKTKPADDEMLFIYSHYKQATVGDINTERPGILDLKGKAKWDAWNGLKGTSKEDAMKAYINKVEELKKKYGI
  • Signal peptide:  NA
  • Modification:  T1 N-acetylserine;T7 N6-acetyllysine;T7 N6-succinyllysine;T16 N6-succinyllysine;T18 N6-acetyllysine;T28 Phosphotyrosine;T50 N6-acetyllysine;T54 N6-(2-hydroxyisobutyryl)lysine;T54 N6-acetyllysine;T54 N6-malonyllysine;T54 N6-succinyllysine;T76 N6-acetyllysi
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P12026-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006532_AF2.pdbhor006532_ESM.pdb

Physical Information

Mass: 1128148 Formula: C438H694N114O134S2
Absent amino acids: C Common amino acids: K
pI: 8.84 Basic residues: 17
Polar residues: 21 Hydrophobic residues: 27
Hydrophobicity: -86.05 Boman Index: -17163
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 70.47
Instability Index: 2518.6 Extinction Coefficient cystines: 16960
Absorbance 280nm: 199.53

Literature

  • PubMed ID:  3289918
  • Title:  Isolation and characterization of porcine diazepam-binding inhibitor, a polypeptide not only of cerebral occurrence but also common in intestinal tissues and with effects on regulation of insulin release.
  • PubMed ID:  8375398
  • Title:  Isolation of three antibacterial peptides from pi